PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624151.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 324aa    MW: 37002.1 Da    PI: 4.9708
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624151.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-5361341128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rdkky++g+r+nratk gyWkatgkd++v+
  XP_009624151.1   6 LPPGFRFHPTDEELVGYYLKRKTDGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDMEWFFFCPRDKKYPNGSRTNRATKCGYWKATGKDRKVV 99 
                     79****************************.99**************95344555788************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++ ++vg +ktLvfy+grap g +tdWvmheyrl
  XP_009624151.1 100 CHQPAVVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 134
                     *9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-614157IPR003441NAC domain
PROSITE profilePS5100557.7666157IPR003441NAC domain
PfamPF023651.6E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MEGTSLPPGF RFHPTDEELV GYYLKRKTDG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DMEWFFFCPR DKKYPNGSRT NRATKCGYWK ATGKDRKVVC HQPAVVGYRK TLVFYRGRAP  120
LGDRTDWVMH EYRLCDDVSQ GTPNFQGPFA LCRIIKRNDA SLKTSDTSIA VSNEPVVLTA  180
ETPTQTTYMC NDSNYSTPIT SPYEGTNATN FWMSHDMILD SSKECPQGQS TRGDYPNYDF  240
PNMTLAQPND RLEFTSSSSF PSFRGEVELS GDLSSYGCVS PYSVHGNYTG FYGNDDMSYE  300
GYEGWNQANM GDFNGLWSHK DNFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-52516316171NO APICAL MERISTEM PROTEIN
1ut4_B7e-52516316171NO APICAL MERISTEM PROTEIN
1ut7_A7e-52516316171NO APICAL MERISTEM PROTEIN
1ut7_B7e-52516316171NO APICAL MERISTEM PROTEIN
3swm_A9e-52516319174NAC domain-containing protein 19
3swm_B9e-52516319174NAC domain-containing protein 19
3swm_C9e-52516319174NAC domain-containing protein 19
3swm_D9e-52516319174NAC domain-containing protein 19
3swp_A9e-52516319174NAC domain-containing protein 19
3swp_B9e-52516319174NAC domain-containing protein 19
3swp_C9e-52516319174NAC domain-containing protein 19
3swp_D9e-52516319174NAC domain-containing protein 19
4dul_A7e-52516316171NAC domain-containing protein 19
4dul_B7e-52516316171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624151.10.0PREDICTED: NAC domain-containing protein 72-like
TrEMBLM1BH481e-180M1BH48_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000451291e-180(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-103NAC domain containing protein 71